VIMSS10109942 has 326 amino acids
Query: DUF761 [M=36] Accession: PF05553.16 Description: Cotton fibre expressed protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-21 61.0 2.3 6e-21 60.1 2.3 1.5 1 VIMSS10109942 Domain annotation for each sequence (and alignments): >> VIMSS10109942 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.1 2.3 6e-21 6e-21 1 35 [. 287 321 .. 287 322 .. 0.97 Alignments for each domain: == domain 1 score: 60.1 bits; conditional E-value: 6e-21 DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryqemla 35 +ee+++++EaFI+kF+e++rLQR+eS+ +y+em++ VIMSS10109942 287 QEELNRRVEAFIKKFNEEMRLQRLESLAKYNEMVN 321 79*******************************98 PP
Or compare VIMSS10109942 to CDD or PaperBLAST