VIMSS10109942 has 326 amino acids
Query: DUF4408 [M=33]
Accession: PF14364.11
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-15 42.3 3.8 4.8e-15 41.4 3.8 1.5 1 VIMSS10109942
Domain annotation for each sequence (and alignments):
>> VIMSS10109942
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 41.4 3.8 4.8e-15 4.8e-15 1 33 [] 44 76 .. 44 76 .. 0.98
Alignments for each domain:
== domain 1 score: 41.4 bits; conditional E-value: 4.8e-15
DUF4408 1 PslwsslrswltPpyLFvvlNvIIitIaasSrl 33
P++++++ ++l+PpyL++v+N II++I+a+S+l
VIMSS10109942 44 PIIYDNTVFLLKPPYLYLVINSIIVCIIATSKL 76
99*****************************98 PP
Or compare VIMSS10109942 to CDD or PaperBLAST