PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10109942 to PF14364 (DUF4408)

VIMSS10109942 has 326 amino acids

Query:       DUF4408  [M=33]
Accession:   PF14364.11
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.5e-15   42.3   3.8    4.8e-15   41.4   3.8    1.5  1  VIMSS10109942  


Domain annotation for each sequence (and alignments):
>> VIMSS10109942  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   41.4   3.8   4.8e-15   4.8e-15       1      33 []      44      76 ..      44      76 .. 0.98

  Alignments for each domain:
  == domain 1  score: 41.4 bits;  conditional E-value: 4.8e-15
        DUF4408  1 PslwsslrswltPpyLFvvlNvIIitIaasSrl 33
                   P++++++ ++l+PpyL++v+N II++I+a+S+l
  VIMSS10109942 44 PIIYDNTVFLLKPPYLYLVINSIIVCIIATSKL 76
                   99*****************************98 PP



Or compare VIMSS10109942 to CDD or PaperBLAST