VIMSS10109956 has 91 amino acids
Query: DUF295 [M=259]
Accession: PF03478.22
Description: Domain of unknown function (DUF295)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.9e-11 27.8 0.1 1e-10 27.7 0.1 1.1 1 VIMSS10109956
Domain annotation for each sequence (and alignments):
>> VIMSS10109956
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 27.7 0.1 1e-10 1e-10 192 247 .. 5 58 .. 1 79 [. 0.81
Alignments for each domain:
== domain 1 score: 27.7 bits; conditional E-value: 1e-10
DUF295 192 rtvefeVykldleeeakweevesLgdralFlgsnssfsvsasdfpglkgNcIYftd 247
+t+ ++V+kld+e + +++gd +F+++ f+v+as+fpg+ N + +d
VIMSS10109956 5 QTKAVMVFKLDEEGN--AFYTQDIGDLYIFISRSEPFCVPASSFPGMFSNFVELLD 58
67899******9754..45679***************************9997666 PP
Or compare VIMSS10109956 to CDD or PaperBLAST