VIMSS10110250 has 379 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.3e-21 60.6 0.6 1.6e-20 58.7 0.6 2.0 1 VIMSS10110250
Domain annotation for each sequence (and alignments):
>> VIMSS10110250
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 58.7 0.6 1.6e-20 1.6e-20 2 35 .. 344 377 .. 343 377 .. 0.96
Alignments for each domain:
== domain 1 score: 58.7 bits; conditional E-value: 1.6e-20
DUF761 2 eevDakAEaFIakFreqlrLQRqeSikryqemla 35
+ vDakA +FI+kF++ql+LQR++Si+ry+eml+
VIMSS10110250 344 DGVDAKASDFINKFKQQLKLQRLDSILRYKEMLK 377
89******************************97 PP
Or compare VIMSS10110250 to CDD or PaperBLAST