VIMSS10110262 has 62 amino acids
Query: DUF4516 [M=46]
Accession: PF14990.10
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.2e-23 66.8 0.3 6.1e-23 66.6 0.3 1.1 1 VIMSS10110262
Domain annotation for each sequence (and alignments):
>> VIMSS10110262
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.6 0.3 6.1e-23 6.1e-23 1 45 [. 9 51 .. 9 52 .. 0.96
Alignments for each domain:
== domain 1 score: 66.6 bits; conditional E-value: 6.1e-23
DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekke 45
+P+G++++++++lv +v+S+laGA+vVHn+YKPdl++p+ e++e
VIMSS10110262 9 LPTGTPSLAMSTLV--VVASLLAGASVVHNIYKPDLSLPPLESSE 51
5*************..*************************9987 PP
Or compare VIMSS10110262 to CDD or PaperBLAST