VIMSS10110779 has 155 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.8e-14 37.2 1.3 2e-13 36.0 1.3 1.7 1 VIMSS10110779
Domain annotation for each sequence (and alignments):
>> VIMSS10110779
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 36.0 1.3 2e-13 2e-13 1 31 [. 117 147 .. 117 149 .. 0.90
Alignments for each domain:
== domain 1 score: 36.0 bits; conditional E-value: 2e-13
DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryq 31
d+++D+kAE+FI +F+ q+++Q q + r++
VIMSS10110779 117 DDMIDEKAEEFIVRFYAQMKMQNQVYTDRCK 147
689*******************998877776 PP
Or compare VIMSS10110779 to CDD or PaperBLAST