VIMSS101813 has 210 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.2e-14 38.5 0.8 6.4e-14 38.0 0.8 1.3 1 VIMSS101813
Domain annotation for each sequence (and alignments):
>> VIMSS101813
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 38.0 0.8 6.4e-14 6.4e-14 1 56 [] 139 194 .. 139 194 .. 0.97
Alignments for each domain:
== domain 1 score: 38.0 bits; conditional E-value: 6.4e-14
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
+t++Y+q+++ +lL q +t +++ ++d+++ t+++++e+ve++++ Lt+ +G+
VIMSS101813 139 ITLSYPQYQLYSNLLDQLALTETETKFSDTIKTTLYCDTERVENLIDTLTNYYHGQ 194
799************************************************88886 PP
Or compare VIMSS101813 to CDD or PaperBLAST