VIMSS101818 has 228 amino acids
Query: LiaF-like_C [M=114]
Accession: PF09922.13
Description: Cell wall-active antibiotics response LiaF, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-32 97.8 1.0 3e-32 97.2 1.0 1.3 1 VIMSS101818
Domain annotation for each sequence (and alignments):
>> VIMSS101818
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 97.2 1.0 3e-32 3e-32 1 94 [. 132 225 .. 132 228 .] 0.98
Alignments for each domain:
== domain 1 score: 97.2 bits; conditional E-value: 3e-32
LiaF-like_C 1 liGdqklgkepyelediniqrviGdttiDLskavlpkgetvivirkliGdvkilVPedvevsveasvifGsvtvldekeagllnesvkleseey 94
+iG+ +++++ y ++dini r++G++t+DL++++++ +++ivirk++G+++ilVP dv+v++++s+i+Gsv+++ ++++l+nes+k+++++
VIMSS101818 132 WIGTANYESDYYCFDDINIIRISGNDTVDLTNVIVTGMDNIIVIRKIFGNTTILVPIDVTVTLDVSSIYGSVDFFRCQQYDLRNESIKFKETDN 225
9****************************************************************************************99885 PP
Or compare VIMSS101818 to CDD or PaperBLAST