VIMSS102372 has 157 amino acids
Query: DUF1648 [M=49] Accession: PF07853.15 Description: Domain of unknown function (DUF1648) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-18 49.9 0.1 9.8e-18 49.9 0.1 2.6 2 VIMSS102372 Domain annotation for each sequence (and alignments): >> VIMSS102372 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.1 9.8e-18 9.8e-18 1 43 [. 13 55 .. 13 61 .. 0.88 2 ? -2.4 2.5 0.22 0.22 2 17 .. 132 147 .. 131 150 .. 0.55 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 9.8e-18 DUF1648 1 llillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfl 43 l+ l+++ ++++ y+kLP ++P+H+n++G +D++++K++ l++ VIMSS102372 13 LIYLAMMCYTVVTYSKLPTKVPIHYNLAGDADNFADKWVLLLI 55 6889*********************************555544 PP == domain 2 score: -2.4 bits; conditional E-value: 0.22 DUF1648 2 lillplvlglilypkL 17 ++++ + l+l+++ L VIMSS102372 132 IFIIIIGLTLVIFCLL 147 5566666666655444 PP
Or compare VIMSS102372 to CDD or PaperBLAST