VIMSS102429 has 127 amino acids
Query: DUF454 [M=115] Accession: PF04304.17 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-41 126.0 8.0 4.3e-41 125.8 8.0 1.0 1 VIMSS102429 Domain annotation for each sequence (and alignments): >> VIMSS102429 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 125.8 8.0 4.3e-41 4.3e-41 1 112 [. 2 113 .. 2 117 .. 0.97 Alignments for each domain: == domain 1 score: 125.8 bits; conditional E-value: 4.3e-41 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwvkil 98 rl+l+v+Gl+++alG++G+vlPlLPTtpFlL+A+fcfarss+r+++wL+++k++++y++++ +r+ +l++K+ +l+++++++++s+++v++l+v++ VIMSS102429 2 RLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVENFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVG 99 789*********************************************************************************************** PP DUF454 99 lalvlllvllyllr 112 l++++++ +++l++ VIMSS102429 100 LIIMVIIQTAVLFT 113 ********999965 PP
Or compare VIMSS102429 to CDD or PaperBLAST