VIMSS102984 has 213 amino acids
Query: DUF1949 [M=56] Accession: PF09186.15 Description: Domain of unknown function (DUF1949) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-19 54.4 2.4 1.6e-18 52.7 0.2 2.4 3 VIMSS102984 Domain annotation for each sequence (and alignments): >> VIMSS102984 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.1 0.69 0.69 39 49 .. 33 43 .. 33 44 .. 0.78 2 ? 1.1 0.0 0.02 0.02 14 37 .. 112 136 .. 112 138 .. 0.82 3 ! 52.7 0.2 1.6e-18 1.6e-18 1 56 [] 140 195 .. 140 195 .. 0.98 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.69 DUF1949 39 eeeveafkqaL 49 e+e+ af++a+ VIMSS102984 33 EDEAKAFIAAI 43 57888999887 PP == domain 2 score: 1.1 bits; conditional E-value: 0.02 DUF1949 14 lLeqfgatildeeYtdd.Vtltvev 37 l++++++ ++d+ Y+ V+l+ +v VIMSS102984 112 LIRAYSGAVRDVIYDVGrVELREAV 136 68999*********99888887555 PP == domain 3 score: 52.7 bits; conditional E-value: 1.6e-18 DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56 +t++Y+q gk++++L++ ++++++++Ytd+V + + v +++ eaf++ L+++t+G+ VIMSS102984 140 VTLNYDQTGKFEYELASTHFMLRNQTYTDKVSYYIDVVKSDYEAFINFLNQMTAGN 195 799***************************************************96 PP
Or compare VIMSS102984 to CDD or PaperBLAST