PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10322802 to PF08551 (DUF1751)

VIMSS10322802 has 319 amino acids

Query:       DUF1751  [M=99]
Accession:   PF08551.14
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.1e-10   26.2   1.5    5.1e-10   26.2   1.5    2.1  3  VIMSS10322802  


Domain annotation for each sequence (and alignments):
>> VIMSS10322802  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.1   0.0      0.33      0.33      66      97 ..      97     127 ..      92     129 .. 0.58
   2 !   26.2   1.5   5.1e-10   5.1e-10       6      67 ..     132     193 ..     122     198 .. 0.94
   3 ?   -2.5   0.3      0.44      0.44      55      68 ..     221     234 ..     211     253 .. 0.60

  Alignments for each domain:
  == domain 1  score: -2.1 bits;  conditional E-value: 0.33
        DUF1751  66 tlllylvtkseelllvplsGligilvgflval 97 
                     l+l+ +t   + llv   G ++++ +++v  
  VIMSS10322802  97 ILALMGITFFAQ-LLVGTFGSASLQRSLFVLT 127
                    344444555555.5566667778887777765 PP

  == domain 2  score: 26.2 bits;  conditional E-value: 5.1e-10
        DUF1751   6 pypwtlltasfvelnvfkvlvslltLllggkylErlWgskEllkFilvvnvitnllvvlltl 67 
                     y+wt +t+ f    +++++++++ ++++g ++Er+ gs+ +l+ +lv + i++l  v++++
  VIMSS10322802 132 EYVWTWVTSIFAHGGIVHIAFNAIVIFFFGPLVERYIGSRNFLILFLVSGAIAGLSQVAIQI 193
                    49*****************************************************9988776 PP

  == domain 3  score: -2.5 bits;  conditional E-value: 0.44
        DUF1751  55 nvitnllvvlltll 68 
                     + +nl v+l++++
  VIMSS10322802 221 ILNPNLTVYLYMIV 234
                    44455555555544 PP



Or compare VIMSS10322802 to CDD or PaperBLAST