PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS104000 to PF04167 (DUF402)

VIMSS104000 has 180 amino acids

Query:       DUF402  [M=68]
Accession:   PF04167.18
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-23   68.9   3.8    1.8e-23   68.9   3.8    1.7  2  VIMSS104000  


Domain annotation for each sequence (and alignments):
>> VIMSS104000  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   68.9   3.8   1.8e-23   1.8e-23       2      68 .]      63     127 ..      62     127 .. 0.96
   2 ?   -3.2   0.2      0.56      0.56      48      54 ..     138     144 ..     138     151 .. 0.61

  Alignments for each domain:
  == domain 1  score: 68.9 bits;  conditional E-value: 1.8e-23
                  -EEEEE-TT-SEEEEEEEETTTEEEEEEEEEES--EE..E.EEE-EEEEEEESEEE......-HHHH CS
       DUF402   2 lalwllplgewynvtkfldedgrfkgwYvniatppergegtvkyiDldLDvvvypdgevevlDedEl 68 
                  +a+++++   w+nv+++++e  +++++Y+n+++p   +e+++kyiD+dLD++vyp+g++++lDedE+
  VIMSS104000  63 PAIVYFHSEYWFNVICMFRE--DGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEY 127
                  7899****************..7***********99988***************************7 PP

  == domain 2  score: -3.2 bits;  conditional E-value: 0.56
                  EEEEEES CS
       DUF402  48 ldLDvvv 54 
                  +d+D++ 
  VIMSS104000 138 HDIDIIL 144
                  6899984 PP



Or compare VIMSS104000 to CDD or PaperBLAST