VIMSS10408299 has 109 amino acids
Query: DUF1869 [M=59] Accession: PF08956.14 Description: Domain of unknown function (DUF1869) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-09 23.7 0.0 3.9e-09 22.6 0.0 1.5 2 VIMSS10408299 Domain annotation for each sequence (and alignments): >> VIMSS10408299 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.27 0.27 28 38 .. 31 41 .. 22 44 .. 0.58 2 ! 22.6 0.0 3.9e-09 3.9e-09 3 56 .. 54 107 .. 52 108 .. 0.94 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.27 DUF1869 28 LkdpevaAdvv 38 + + aA +v VIMSS10408299 31 VDTRAAAAAIV 41 33444555555 PP == domain 2 score: 22.6 bits; conditional E-value: 3.9e-09 DUF1869 3 aefllTvTNknNGVSVDkdfsslaeLkdpevaAdvvKdLiNivRgYdsdeetnv 56 +e+ l +TN G+SV+ + e + p+ +K ++ iv gY++ eet + VIMSS10408299 54 QEISLSLTNAASGISVELHHPASGESATPAFIEGELKKIVQIVDGYEAAEETHI 107 678899*********************************************987 PP
Or compare VIMSS10408299 to CDD or PaperBLAST