PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10408299 to PF08956 (DUF1869)

VIMSS10408299 has 109 amino acids

Query:       DUF1869  [M=59]
Accession:   PF08956.14
Description: Domain of unknown function (DUF1869)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.8e-09   23.7   0.0    3.9e-09   22.6   0.0    1.5  2  VIMSS10408299  


Domain annotation for each sequence (and alignments):
>> VIMSS10408299  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.5   0.0      0.27      0.27      28      38 ..      31      41 ..      22      44 .. 0.58
   2 !   22.6   0.0   3.9e-09   3.9e-09       3      56 ..      54     107 ..      52     108 .. 0.94

  Alignments for each domain:
  == domain 1  score: -2.5 bits;  conditional E-value: 0.27
        DUF1869 28 LkdpevaAdvv 38
                   +   + aA +v
  VIMSS10408299 31 VDTRAAAAAIV 41
                   33444555555 PP

  == domain 2  score: 22.6 bits;  conditional E-value: 3.9e-09
        DUF1869   3 aefllTvTNknNGVSVDkdfsslaeLkdpevaAdvvKdLiNivRgYdsdeetnv 56 
                    +e+ l +TN   G+SV+    +  e + p+     +K ++ iv gY++ eet +
  VIMSS10408299  54 QEISLSLTNAASGISVELHHPASGESATPAFIEGELKKIVQIVDGYEAAEETHI 107
                    678899*********************************************987 PP



Or compare VIMSS10408299 to CDD or PaperBLAST