VIMSS10443598 has 218 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.9e-18 51.4 0.0 1.2e-17 50.4 0.0 1.5 1 VIMSS10443598
Domain annotation for each sequence (and alignments):
>> VIMSS10443598
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 50.4 0.0 1.2e-17 1.2e-17 10 78 .. 57 125 .. 56 126 .. 0.96
Alignments for each domain:
== domain 1 score: 50.4 bits; conditional E-value: 1.2e-17
CM_2 10 elleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
l +L+aeR+ +a+++a++K + p+ dp Re+++l+ +++ a lgldp+av+++fr+ i++ + +Q
VIMSS10443598 57 ALTDLFAERLLVADKVAAAKYGTATPIDDPVREKAILDDVAARAVGLGLDPDAVTAVFRDQIEANKLVQ 125
589*************************************************************99888 PP
Or compare VIMSS10443598 to CDD or PaperBLAST