VIMSS10444373 has 215 amino acids
Query: DUF4360 [M=178] Accession: PF14273.10 Description: Domain of unknown function (DUF4360) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-76 242.1 1.2 2e-76 241.9 1.2 1.0 1 VIMSS10444373 Domain annotation for each sequence (and alignments): >> VIMSS10444373 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 241.9 1.2 2e-76 2e-76 1 178 [] 33 212 .. 33 212 .. 0.98 Alignments for each domain: == domain 1 score: 241.9 bits; conditional E-value: 2e-76 DUF4360 1 dkitiksvsvsGsGCpqgtasvqvspdntaftvtfddftaqigpgasptdsrknCqlnlnvkvpqGfqfavasadyrGyasldagvtatlkatyyf 96 dki ik+++v+GsGCpqgta+v+vspdntaftvt++d+ aq+g ga++t rknCqlnl v+vp Gf++a+as+dyrG+asl++g+++++ka+yyf VIMSS10444373 33 DKIVIKVATVNGSGCPQGTAAVAVSPDNTAFTVTYSDYLAQVGGGAPSTAFRKNCQLNLIVHVPGGFTYAIASVDYRGFASLARGASGVEKASYYF 128 5899******************************************************************************************** PP DUF4360 97 sgdseqtststtlsGplsgdytltdevevastvwspCGesailnintelrv..tsssskasglitvdstdgavtqtyhlawrkC 178 +g+ +++s ++t++Gp +++++ tde+++a+ vw+pCG ++++nintelrv ss+ ++++++t+dstdg+++++yhlaw++C VIMSS10444373 129 QGSPDTASRTHTFTGPKEDNWQATDETDWAQLVWAPCGVERNFNINTELRVnrGSSPASSTSFMTMDSTDGDISTIYHLAWKQC 212 ***************************************************877789999************************ PP
Or compare VIMSS10444373 to CDD or PaperBLAST