VIMSS10455463 has 209 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-16 45.0 0.0 7.1e-16 44.2 0.0 1.4 1 VIMSS10455463
Domain annotation for each sequence (and alignments):
>> VIMSS10455463
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 44.2 0.0 7.1e-16 7.1e-16 1 56 [] 137 192 .. 137 192 .. 0.98
Alignments for each domain:
== domain 1 score: 44.2 bits; conditional E-value: 7.1e-16
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
l++dY++++ lqr+L + ++i d+e+ d++ ++++ee+v+++++ Lte ++G+
VIMSS10455463 137 LNLDYSLYDSLQRFLIDQKIKISDSEFLSDIKVKCFIDEEKVDEVMNLLTETFNGK 192
689****************************************************7 PP
Or compare VIMSS10455463 to CDD or PaperBLAST