VIMSS10478747 has 107 amino acids
Query: DUF446 [M=98]
Accession: PF04287.16
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-37 114.1 0.4 1.5e-37 113.9 0.4 1.0 1 VIMSS10478747
Domain annotation for each sequence (and alignments):
>> VIMSS10478747
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 113.9 0.4 1.5e-37 1.5e-37 1 98 [] 6 103 .. 6 103 .. 0.98
Alignments for each domain:
== domain 1 score: 113.9 bits; conditional E-value: 1.5e-37
DUF446 1 evaelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwvfiprmkalieaeqpLPkavaiapmaeealkeeeeekeellallkelD 96
+v+e+L ++e+ L++++lWq ap +ea++stePF++dt+++ +WLqw+++p+m+al++a++pLP ++aiap++e al+++ e+++ll+ll+e+D
VIMSS10478747 6 QVQERLLAIESLLKQAGLWQYVAPVSEAFTSTEPFCIDTMTPLQWLQWILLPKMQALLDAGAPLPPSLAIAPYYEVALEGDIPERARLLHLLNEFD 101
68999******************************************************************************************* PP
DUF446 97 el 98
+l
VIMSS10478747 102 QL 103
96 PP
Or compare VIMSS10478747 to CDD or PaperBLAST