PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10478747 to PF04287 (DUF446)

VIMSS10478747 has 107 amino acids

Query:       DUF446  [M=98]
Accession:   PF04287.17
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    9.9e-38  114.5   0.4    1.1e-37  114.3   0.4    1.0  1  VIMSS10478747  


Domain annotation for each sequence (and alignments):
>> VIMSS10478747  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  114.3   0.4   1.1e-37   1.1e-37       1      98 []       6     103 ..       6     103 .. 0.98

  Alignments for each domain:
  == domain 1  score: 114.3 bits;  conditional E-value: 1.1e-37
         DUF446   1 kvaelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwiflprmkalieaeqpLPkavaiapmaeealkeeeeeaaellallkelD 96 
                    +v+e+L ++e+ L++++lWq  ap +ea++stePF++dt+++ +WLqwi+lp+m+al++a++pLP ++aiap++e al+++  e+a+ll+ll+e+D
  VIMSS10478747   6 QVQERLLAIESLLKQAGLWQYVAPVSEAFTSTEPFCIDTMTPLQWLQWILLPKMQALLDAGAPLPPSLAIAPYYEVALEGDIPERARLLHLLNEFD 101
                    68999******************************************************************************************* PP

         DUF446  97 el 98 
                    +l
  VIMSS10478747 102 QL 103
                    96 PP



Or compare VIMSS10478747 to CDD or PaperBLAST