PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1053680 to PF06568 (DUF1127)

VIMSS1053680 has 48 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.8e-22   63.4   0.1    8.4e-22   63.1   0.1    1.1  1  VIMSS1053680  


Domain annotation for each sequence (and alignments):
>> VIMSS1053680  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   63.1   0.1   8.4e-22   8.4e-22       1      37 []       3      39 ..       3      39 .. 0.96

  Alignments for each domain:
  == domain 1  score: 63.1 bits;  conditional E-value: 8.4e-22
       DUF1127  1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
                  l++ +++Wrr+R+t++eL++Ls reL+D+G+sR+di+
  VIMSS1053680  3 LFRSYNNWRRYRETVNELNQLSTRELNDLGISRADIP 39
                  6899*******************************95 PP



Or compare VIMSS1053680 to CDD or PaperBLAST