VIMSS1055629 has 45 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.16
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-18 52.8 1.1 1.4e-18 52.7 1.1 1.0 1 VIMSS1055629
Domain annotation for each sequence (and alignments):
>> VIMSS1055629
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.7 1.1 1.4e-18 1.4e-18 1 37 [] 3 39 .. 3 39 .. 0.96
Alignments for each domain:
== domain 1 score: 52.7 bits; conditional E-value: 1.4e-18
DUF1127 1 lraalrrWrryRrtrreLarLsDreLaDIGLsRsdir 37
+r+++ ++ +Rr +reL++++D++LaDIG+sRs+i+
VIMSS1055629 3 IRQKVMQYVSRRRALRELGAMDDHLLADIGVSRSQIQ 39
6899*******************************95 PP
Or compare VIMSS1055629 to CDD or PaperBLAST