VIMSS1100678 has 95 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-18 52.9 2.5 2.8e-18 52.4 2.5 1.2 1 VIMSS1100678
Domain annotation for each sequence (and alignments):
>> VIMSS1100678
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.4 2.5 2.8e-18 2.8e-18 2 78 .. 7 82 .. 7 83 .. 0.91
Alignments for each domain:
== domain 1 score: 52.4 bits; conditional E-value: 2.8e-18
CM_2 2 keIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
++Id iD++l +L+++Rm++++eia++K +n++ + +Re++v++++ + ee + + ++ ++++++i +++Q
VIMSS1100678 7 QKIDGIDQQLAALFEQRMAVVDEIAQIKFDNQIGLTNIQREKAVMDQRLAAVEEPK-FEPYIVDLYQTMILIAKQYQ 82
68************************************************554445.566788*******9999998 PP
Or compare VIMSS1100678 to CDD or PaperBLAST