VIMSS1112145 has 224 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.12
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-42 127.8 1.2 5.3e-42 127.8 1.2 1.7 2 VIMSS1112145
Domain annotation for each sequence (and alignments):
>> VIMSS1112145
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.5 0.3 0.22 0.22 20 29 .. 25 31 .. 14 37 .. 0.54
2 ! 127.8 1.2 5.3e-42 5.3e-42 2 95 .] 112 205 .. 111 205 .. 0.99
Alignments for each domain:
== domain 1 score: -2.5 bits; conditional E-value: 0.22
DUF5981 20 ekCkaCgeCv 29
Cg Cv
VIMSS1112145 25 VG---CGGCV 31
33...44443 PP
== domain 2 score: 127.8 bits; conditional E-value: 5.3e-42
DUF5981 2 pavntlflgveeevkvleekCkaCgeCvlaetggiCpvtrCpksllnGpCgGskngkCevkpekeCawvliyerlkklgrleklekivppkdws 95
pa+nt+f+g + +++v+ee+C CgeC+l +tggiCp+ rC+ks+lnGpCgGs+ gkCev+pe++Caw+liy+r+++lg+l+ l++i+ppkdws
VIMSS1112145 112 PALNTKFAGGTVAHGVWEERCGLCGECILYKTGGICPIIRCSKSILNGPCGGSQGGKCEVNPETPCAWQLIYDRMQALGKLDLLMEIQPPKDWS 205
899******************************************************************************************6 PP
Or compare VIMSS1112145 to CDD or PaperBLAST