VIMSS1140681 has 86 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-39 120.0 3.1 2.5e-39 119.9 3.1 1.0 1 VIMSS1140681
Domain annotation for each sequence (and alignments):
>> VIMSS1140681
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.9 3.1 2.5e-39 2.5e-39 2 79 .] 9 85 .. 8 85 .. 0.98
Alignments for each domain:
== domain 1 score: 119.9 bits; conditional E-value: 2.5e-39
DUF4212 2 kaYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygve 79
+aYw an+r+ili L+iWf++sfglgi+++++l+ i+ ++g +lgFwfa+qgsi+vf+vlifvYa+rmn+lDr+ygv+
VIMSS1140681 9 NAYWSANVRIILISLAIWFACSFGLGIILRPALEGIM-VGGADLGFWFAQQGSIYVFLVLIFVYAWRMNKLDREYGVD 85
79**********************************7.**************************************96 PP
Or compare VIMSS1140681 to CDD or PaperBLAST