VIMSS1140981 has 174 amino acids
Query: DUF308 [M=73] Accession: PF03729.18 Description: Short repeat of unknown function (DUF308) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-25 73.1 40.2 9.6e-16 44.2 13.3 3.0 3 VIMSS1140981 Domain annotation for each sequence (and alignments): >> VIMSS1140981 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.2 13.3 9.6e-16 9.6e-16 1 73 [] 9 79 .. 9 79 .. 0.93 2 ! 34.5 18.8 9.8e-13 9.8e-13 3 72 .. 67 135 .. 65 136 .. 0.92 3 ! 14.4 1.5 1.9e-06 1.9e-06 12 50 .. 134 172 .. 133 174 .] 0.92 Alignments for each domain: == domain 1 score: 44.2 bits; conditional E-value: 9.6e-16 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilsiiaGllllf 73 ++Gil+++ Gi+al++P+ ++la+++l G ++++sG+++l+aaf+ r+ +g +++++s++aG+++l+ VIMSS1140981 9 VSGILALLGGIAALAFPLPVSLAVTVLAGCVFVASGAFGLWAAFSDRGMPSRG--AAAFFSLVSLVAGVWMLA 79 58******************************************888877766..5689************95 PP == domain 2 score: 34.5 bits; conditional E-value: 9.8e-13 DUF308 3 GilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilsiiaGllll 72 +++++++G+++l++P+a ++ l++++G+l+lvsG+v+l ++a+++ + fwl+ lsG++s +Gl++l VIMSS1140981 67 SLVSLVAGVWMLANPLAGMVSLTLMLGALFLVSGVVRLGLSLATWR-GTVMFWLMALSGLISAGLGLFIL 135 6899**********************************88887777.666799999************98 PP == domain 3 score: 14.4 bits; conditional E-value: 1.9e-06 DUF308 12 laliwPgaallalviliGvlllvsGivqlvaafaarkke 50 ++l +P a+l++l +l++v l+v G++ ++ +fa+rk++ VIMSS1140981 134 ILLRLPEASLVLLGTLVAVELIVMGATLVAMGFALRKSG 172 7899*****************************999865 PP
Or compare VIMSS1140981 to CDD or PaperBLAST