VIMSS1141228 has 62 amino acids
Query: DUF1674 [M=50]
Accession: PF07896.16
Description: Protein of unknown function (DUF1674)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-20 60.0 1.6 1.4e-20 59.8 1.1 1.4 1 VIMSS1141228
Domain annotation for each sequence (and alignments):
>> VIMSS1141228
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.8 1.1 1.4e-20 1.4e-20 6 50 .] 18 62 .] 14 62 .] 0.84
Alignments for each domain:
== domain 1 score: 59.8 bits; conditional E-value: 1.4e-20
DUF1674 6 raaaakpakefekdvnpktgEigGpkgpEPtRygDWerkGrvsDF 50
ra a++++++ + + + ++EigG+ gpEP+R+gDWe+kG+++DF
VIMSS1141228 18 RALAEAEERRRRAKALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF 62
66666666677777778899************************* PP
Or compare VIMSS1141228 to CDD or PaperBLAST