VIMSS1182502 has 267 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.7e-23 66.7 0.4 1.2e-22 65.9 0.4 1.4 1 VIMSS1182502
Domain annotation for each sequence (and alignments):
>> VIMSS1182502
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 65.9 0.4 1.2e-22 1.2e-22 1 43 [. 15 56 .. 15 61 .. 0.94
Alignments for each domain:
== domain 1 score: 65.9 bits; conditional E-value: 1.2e-22
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlar 43
sPCigvC+ld ++++C+GC+R+ldEia+W++msd+er++ l++
VIMSS1182502 15 SPCIGVCSLD-AQSHCVGCLRSLDEIARWMSMSDAERQDYLHT 56
9*********.***************************99876 PP
Or compare VIMSS1182502 to CDD or PaperBLAST