VIMSS123441 has 98 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.5e-14 37.8 4.6 6.5e-14 37.8 4.6 1.6 2 VIMSS123441
Domain annotation for each sequence (and alignments):
>> VIMSS123441
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 37.8 4.6 6.5e-14 6.5e-14 2 37 .] 30 65 .. 29 65 .. 0.94
2 ? -2.4 0.3 0.24 0.24 8 12 .. 83 87 .. 80 96 .. 0.54
Alignments for each domain:
== domain 1 score: 37.8 bits; conditional E-value: 6.5e-14
DUF1127 2 raalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
+ a++r +r+R++++ L++L+Dr+L D+GL R+d++
VIMSS123441 30 LTAVWRLYRNRCQIARLQDLDDRQLLDMGLKREDLH 65
6799******************************85 PP
== domain 2 score: -2.4 bits; conditional E-value: 0.24
DUF1127 8 WrrrR 12
r+R
VIMSS123441 83 ASRNR 87
33333 PP
Or compare VIMSS123441 to CDD or PaperBLAST