PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS123441 to PF06568 (DUF1127)

VIMSS123441 has 98 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.5e-14   37.8   4.6    6.5e-14   37.8   4.6    1.6  2  VIMSS123441  


Domain annotation for each sequence (and alignments):
>> VIMSS123441  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.8   4.6   6.5e-14   6.5e-14       2      37 .]      30      65 ..      29      65 .. 0.94
   2 ?   -2.4   0.3      0.24      0.24       8      12 ..      83      87 ..      80      96 .. 0.54

  Alignments for each domain:
  == domain 1  score: 37.8 bits;  conditional E-value: 6.5e-14
      DUF1127  2 raalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
                 + a++r +r+R++++ L++L+Dr+L D+GL R+d++
  VIMSS123441 30 LTAVWRLYRNRCQIARLQDLDDRQLLDMGLKREDLH 65
                 6799******************************85 PP

  == domain 2  score: -2.4 bits;  conditional E-value: 0.24
      DUF1127  8 WrrrR 12
                   r+R
  VIMSS123441 83 ASRNR 87
                 33333 PP



Or compare VIMSS123441 to CDD or PaperBLAST