VIMSS1235281 has 168 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-54 169.7 0.1 2.9e-54 169.6 0.1 1.0 1 VIMSS1235281 Domain annotation for each sequence (and alignments): >> VIMSS1235281 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.6 0.1 2.9e-54 2.9e-54 4 158 .. 5 156 .. 2 157 .. 0.98 Alignments for each domain: == domain 1 score: 169.6 bits; conditional E-value: 2.9e-54 DUF892 4 elfideLrDayaaEkqalkalpkmakaaes.peLkaaleqHleeTeqqierleqvferlgeeasekkcdameglvaegqelleeaiedeevkdaali 99 e+++d+LrDa+a+Ekqa+++l++ma+++++ peL+a++eqHl+eT++qi +le ++ r + + s +k d m++++a gq++++ + +de+vk+ + VIMSS1235281 5 EHYHDWLRDAHAMEKQAESMLESMASRIDNyPELRARIEQHLSETKNQIVQLETILDRNDISRSVIK-DSMSKIAALGQSIGGIFPSDEIVKGSI-- 98 89*****************************************************************.***************************.. PP DUF892 100 aaaqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqea 158 +++++e++Eia+Y++L+a+A+++g++ ++e++l+ Ek ++++L +++++++++++ VIMSS1235281 99 -SGYVFEQFEIACYTSLLAAAKNAGDTASIPIIEAILNDEKHMADWLIQHIPQTTEKFL 156 .*****************************************************99875 PP
Or compare VIMSS1235281 to CDD or PaperBLAST