VIMSS1235376 has 88 amino acids
Query: DUF333 [M=48]
Accession: PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-18 53.1 0.3 2.1e-18 52.7 0.3 1.2 1 VIMSS1235376
Domain annotation for each sequence (and alignments):
>> VIMSS1235376
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.7 0.3 2.1e-18 2.1e-18 2 47 .. 38 83 .. 37 84 .. 0.95
Alignments for each domain:
== domain 1 score: 52.7 bits; conditional E-value: 2.1e-18
DUF333 2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrg 47
m ++ +++C+++GG l+++++ dG ig+C+Lp+G+r++e++l g
VIMSS1235376 38 MSSSGEANCAMIGGSLSVARQLDGTAIGMCALPNGKRCSEQSLAAG 83
88999*************************************9876 PP
Or compare VIMSS1235376 to CDD or PaperBLAST