VIMSS1244356 has 143 amino acids
Query: DUF3281 [M=267] Accession: PF11685.12 Description: Protein of unknown function (DUF3281) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-44 137.3 4.7 3.9e-44 137.1 4.7 1.0 1 VIMSS1244356 Domain annotation for each sequence (and alignments): >> VIMSS1244356 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 137.1 4.7 3.9e-44 3.9e-44 98 237 .. 1 140 [. 1 142 [. 0.97 Alignments for each domain: == domain 1 score: 137.1 bits; conditional E-value: 3.9e-44 DUF3281 98 lgsgcqndsctananptafnlqvgsnsisvsgtitvngktvnlastvppvtvdtiqvadshvfqsgtlpagltigdlvtnlninardahgtfs.eqn 193 +g gcq+d ctan+npta++l gsn+isvsgt+tv+gkt++la+ v pv dt+ + +s+ fq g lp+g i lv+ ln na ahgtf+ + VIMSS1244356 1 MGVGCQDDNCTANSNPTAYKLATGSNTISVSGTVTVDGKTIDLATEVQPVVEDTVAIENSYTFQKG-LPSGAIITTLVASLNANAAKAHGTFAaDGS 96 599*************************************************************98.9************************72568 PP DUF3281 194 gtlkitcetgyewiddqdppfgsfttastsrsvamsswlretns 237 g++++t + gy w+ d dp +g+ + r a+++w +tn VIMSS1244356 97 GSFNMTFDKGYTWLKDVDPAYGTEINKGSGRDSALATWDTKTNK 140 9*************************************999995 PP
Or compare VIMSS1244356 to CDD or PaperBLAST