VIMSS125916 has 111 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.7e-26 76.3 0.2 1.2e-25 76.0 0.2 1.1 1 VIMSS125916
Domain annotation for each sequence (and alignments):
>> VIMSS125916
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 76.0 0.2 1.2e-25 1.2e-25 1 77 [. 14 90 .. 14 92 .. 0.98
Alignments for each domain:
== domain 1 score: 76.0 bits; conditional E-value: 1.2e-25
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesral 77
R++Id+iD+ l+++laeR++++k+++ +K++++lp dp+Ree ++erlr a++++ldp+++ek+++ ii+e +++
VIMSS125916 14 RQSIDNIDAALVHMLAERFRCTKAVGVLKAKHQLPPADPAREEYQIERLRHLAKDANLDPDFAEKFLNFIIKEVIRH 90
99***********************************************************************9975 PP
Or compare VIMSS125916 to CDD or PaperBLAST