VIMSS126239 has 62 amino acids
Query: DUF1508 [M=48]
Accession: PF07411.16
Description: Domain of unknown function (DUF1508)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.6e-25 73.1 0.8 7.6e-25 72.9 0.8 1.1 1 VIMSS126239
Domain annotation for each sequence (and alignments):
>> VIMSS126239
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 72.9 0.8 7.6e-25 7.6e-25 1 48 [] 9 56 .. 9 56 .. 0.98
Alignments for each domain:
== domain 1 score: 72.9 bits; conditional E-value: 7.6e-25
DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48
Dk+G++rFr+ka+Nge++++segY++ka+a ++Ies+k+n+++a+++D
VIMSS126239 9 DKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIESIKRNSAGADTVD 56
8********************************************987 PP
Or compare VIMSS126239 to CDD or PaperBLAST