VIMSS1288761 has 166 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-58 182.0 6.6 4.2e-58 181.8 6.6 1.0 1 VIMSS1288761 Domain annotation for each sequence (and alignments): >> VIMSS1288761 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.8 6.6 4.2e-58 4.2e-58 1 146 [] 7 152 .. 7 152 .. 0.99 Alignments for each domain: == domain 1 score: 181.8 bits; conditional E-value: 4.2e-58 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnltls 97 +++lY+eia++i++miP+eWekvy++a++++++gev+F+y+k++s++l+y+++ip++yn+s +++++l+++Ly+l++elr+ fk+e e+Wt+++++ VIMSS1288761 7 ISKLYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTDIPKEYNISVQVFDDLWMDLYDLFEELRDLFKEEGLEPWTSCEFD 103 689********************************************************************************************** PP YezG-like 98 lkksGklkiefnyddllnseldsserkiiwkykklgilpeeekekelle 146 ++++Gklk++f+y d++n+e+d+ r+++++ykk+g+lpe+e+e+e+++ VIMSS1288761 104 FTSEGKLKVSFDYIDWINTEFDQLGRENYYMYKKFGVLPEMEYEMEEIK 152 *********************************************9985 PP
Or compare VIMSS1288761 to CDD or PaperBLAST