VIMSS1288763 has 166 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-54 170.5 9.1 1.5e-54 170.2 9.1 1.0 1 VIMSS1288763 Domain annotation for each sequence (and alignments): >> VIMSS1288763 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 170.2 9.1 1.5e-54 1.5e-54 1 146 [] 7 152 .. 7 152 .. 0.99 Alignments for each domain: == domain 1 score: 170.2 bits; conditional E-value: 1.5e-54 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnltls 97 l+++Y+eia++i+ miP+eWe++y++a+v++++gev+F+y+k++s++l+y++ ip++ynvse+++ +l+++Ly+l+k+lre+fk+e e+Wt+ +++ VIMSS1288763 7 LSQMYNEIANEISGMIPVEWENIYTIAYVTDQGGEVIFNYTKPGSDELNYYTYIPREYNVSEKVFYDLWTDLYRLFKKLRETFKEEGLEPWTSSEFD 103 689********************************************************************************************** PP YezG-like 98 lkksGklkiefnyddllnseldsserkiiwkykklgilpeeekekelle 146 ++++Gklk++f+y d++n+e+d+ r+++++ykk+g+lpe+e+e+e+++ VIMSS1288763 104 FTSEGKLKVSFDYIDWINTEFDQLGRENYYMYKKFGVLPEMEYEMEEVK 152 *********************************************9885 PP
Or compare VIMSS1288763 to CDD or PaperBLAST