VIMSS1289147 has 214 amino acids
Query: DUF402 [M=68]
Accession: PF04167.17
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-21 61.7 0.3 5.4e-21 60.9 0.3 1.5 1 VIMSS1289147
Domain annotation for each sequence (and alignments):
>> VIMSS1289147
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 60.9 0.3 5.4e-21 5.4e-21 1 68 [] 61 128 .. 61 128 .. 0.95
Alignments for each domain:
== domain 1 score: 60.9 bits; conditional E-value: 5.4e-21
DUF402 1 dlalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68
+++l++lp++++y++t+++d++g+ +++Y++i+ + +g +++Dl LDv p+ge+e++Ded+L
VIMSS1289147 61 YKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNARTVDLCLDVLALPSGEYELVDEDDL 128
789*******************************97776699************************97 PP
Or compare VIMSS1289147 to CDD or PaperBLAST