VIMSS1291813 has 166 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-51 159.9 6.2 2.7e-51 159.7 6.2 1.0 1 VIMSS1291813 Domain annotation for each sequence (and alignments): >> VIMSS1291813 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 159.7 6.2 2.7e-51 2.7e-51 1 145 [. 7 151 .. 7 152 .. 0.98 Alignments for each domain: == domain 1 score: 159.7 bits; conditional E-value: 2.7e-51 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnltls 97 l+e+Y++ia++i+ miP+eW++v+++a+v + +ge++F+y+k++s++l+y++ ip++ynvse+++ +l+++Ly+l+k+lr+ fk+e+ e+Wt+++++ VIMSS1291813 7 LSEIYNKIANEISGMIPVEWDQVFTIAYVNDRGGEIVFNYTKPGSDELNYYTYIPREYNVSEKVFYDLWTDLYRLFKKLRNAFKEEDLEPWTSCEFD 103 689********************************************************************************************** PP YezG-like 98 lkksGklkiefnyddllnseldsserkiiwkykklgilpeeekekell 145 ++++Gkl++ f+y d++nse+ + ++++++ykk+g+lpe+e+e +++ VIMSS1291813 104 FTRDGKLNVVFDYVDWMNSEFGPIAKENYYMYKKFGVLPETEYEINKV 151 ******************************************998876 PP
Or compare VIMSS1291813 to CDD or PaperBLAST