VIMSS1291814 has 166 amino acids
Query: YezG-like [M=146] Accession: PF04634.16 Description: Immunity protein YezG-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-54 168.0 6.4 8.5e-54 167.8 6.4 1.1 1 VIMSS1291814 Domain annotation for each sequence (and alignments): >> VIMSS1291814 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 167.8 6.4 8.5e-54 8.5e-54 1 143 [. 7 149 .. 7 152 .. 0.98 Alignments for each domain: == domain 1 score: 167.8 bits; conditional E-value: 8.5e-54 YezG-like 1 lkelYeeiaekiidmiPeeWekvylyaevledsgevyFyylkkesekliysheipekynvseeeykkllkeLyelikelreefkkeeqeaWtnltls 97 l+++Y++ia +i+ miP+eWe+v+++a+v++++gev+F+y+k++s++l+y+++ip+++nvs++++k+++ ++y++++elre+fk+ee e+Wt+++++ VIMSS1291814 7 LSQMYNKIASEISGMIPVEWEQVFTIAYVTDQAGEVIFNYTKPGSDELNYYSDIPKDCNVSKDIFKNSWFKVYRMFDELRETFKEEELEPWTSCEFD 103 689********************************************************************************************** PP YezG-like 98 lkksGklkiefnyddllnseldsserkiiwkykklgilpeeekeke 143 ++++Gkl+++f+y d++nse+ ++ r+ +++ykk+gi pe+e+ + VIMSS1291814 104 FTRDGKLNVSFDYIDWVNSEFGPMGREHYYMYKKFGIWPEKEYAIN 149 ****************************************998766 PP
Or compare VIMSS1291814 to CDD or PaperBLAST