PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1292247 to PF09186 (DUF1949)

VIMSS1292247 has 213 amino acids

Query:       DUF1949  [M=56]
Accession:   PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.6e-18   52.7   0.2    1.6e-18   52.7   0.2    2.1  3  VIMSS1292247  


Domain annotation for each sequence (and alignments):
>> VIMSS1292247  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.8   0.1      0.69      0.69      39      49 ..      33      43 ..      33      44 .. 0.78
   2 ?   -1.3   0.0      0.11      0.11      14      28 ..     112     126 ..     112     137 .. 0.79
   3 !   52.7   0.2   1.6e-18   1.6e-18       1      56 []     140     195 ..     140     195 .. 0.98

  Alignments for each domain:
  == domain 1  score: -3.8 bits;  conditional E-value: 0.69
       DUF1949 39 eeeveafkqaL 49
                  e+e+ af++a+
  VIMSS1292247 33 EDEAKAFIAAI 43
                  57888999887 PP

  == domain 2  score: -1.3 bits;  conditional E-value: 0.11
       DUF1949  14 lLeqfgatildeeYt 28 
                   l++++++ ++d+ Y+
  VIMSS1292247 112 LIRAYSGAVRDVIYD 126
                   578999999999996 PP

  == domain 3  score: 52.7 bits;  conditional E-value: 1.6e-18
       DUF1949   1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56 
                   +t++Y+q gk++++L++ ++++++++Ytd+V + + v +++ eaf++ L+++t+G+
  VIMSS1292247 140 VTLNYDQTGKFEYELASTHFMLRNQTYTDKVSYYIDVVKSDYEAFINFLNQMTAGN 195
                   799***************************************************96 PP



Or compare VIMSS1292247 to CDD or PaperBLAST