VIMSS13294 has 89 amino acids
Query: RemA-like [M=73]
Accession: PF04025.16
Description: Extracellular matrix regulatory protein A-like
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-41 126.0 1.0 3e-41 125.8 1.0 1.1 1 VIMSS13294
Domain annotation for each sequence (and alignments):
>> VIMSS13294
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 125.8 1.0 3e-41 3e-41 1 73 [] 5 77 .. 5 77 .. 0.99
Alignments for each domain:
== domain 1 score: 125.8 bits; conditional E-value: 3e-41
RemA-like 1 liniGfgnvVnadriiaivspdsapikrliqeakeegklidaTqgrktrsviitdsghviLSalqpetlakRl 73
liniGfgn+V+ +r++aivsp+sapikr+i++ake+ +lidaT+gr+tr+vii+ds++viLSa+qpet+a+R+
VIMSS13294 5 LINIGFGNIVSGNRVVAIVSPESAPIKRIISDAKERSQLIDATYGRRTRAVIIMDSNQVILSAIQPETVANRF 77
8***********************************************************************7 PP
Or compare VIMSS13294 to CDD or PaperBLAST