VIMSS134896 has 211 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-18 51.6 0.4 6.3e-18 50.8 0.4 1.5 1 VIMSS134896
Domain annotation for each sequence (and alignments):
>> VIMSS134896
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 50.8 0.4 6.3e-18 6.3e-18 1 56 [] 138 193 .. 138 193 .. 0.98
Alignments for each domain:
== domain 1 score: 50.8 bits; conditional E-value: 6.3e-18
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
++++Yaq++ ++L++++++ ld+++td+V +++v++ee e++k+aL e+++G+
VIMSS134896 138 IQMSYAQYQEYSNFLKEHDLMELDTNFTDQVDTMIYVDKEEKETIKAALVEFFNGK 193
6899***************************************************7 PP
Or compare VIMSS134896 to CDD or PaperBLAST