VIMSS135137 has 93 amino acids
Query: DUF1674 [M=50] Accession: PF07896.16 Description: Protein of unknown function (DUF1674) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-17 49.1 0.6 4.5e-17 48.6 0.1 1.5 2 VIMSS135137 Domain annotation for each sequence (and alignments): >> VIMSS135137 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.42 0.42 10 20 .. 9 19 .. 3 25 .. 0.48 2 ! 48.6 0.1 4.5e-17 4.5e-17 17 50 .] 60 93 .] 51 93 .] 0.90 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.42 DUF1674 10 akpakefekdv 20 ++++++++ VIMSS135137 9 HLSKPAYREEC 19 44444455544 PP == domain 2 score: 48.6 bits; conditional E-value: 4.5e-17 DUF1674 17 ekdvnpktgEigGpkgpEPtRygDWerkGrvsDF 50 ek+ pk +EigG kg+EPtRygDW kG v+DF VIMSS135137 60 EKENLPKEKEIGGVKGLEPTRYGDWQHKGKVTDF 93 56667899************************** PP
Or compare VIMSS135137 to CDD or PaperBLAST