VIMSS1364299 has 120 amino acids
Query: DUF760 [M=83]
Accession: PF05542.16
Description: Protein of unknown function (DUF760)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-34 103.0 0.4 5.6e-34 102.7 0.4 1.1 1 VIMSS1364299
Domain annotation for each sequence (and alignments):
>> VIMSS1364299
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 102.7 0.4 5.6e-34 5.6e-34 1 83 [] 22 104 .. 22 104 .. 0.99
Alignments for each domain:
== domain 1 score: 102.7 bits; conditional E-value: 5.6e-34
DUF760 1 eLlryiqslkpeevkalskpaspevleaikqtvsgllgllpsesfevtietsrekLaqLlassmmtGYfLrnaeqRleLeksl 83
+L++y+q ++p+ +++++++as +++++i+++v+gllg+lp e+fev ++ +r++La++las+mmtGYfLr++eqR eLe+sl
VIMSS1364299 22 SLIQYLQDQSPDVLQRVARSASNDIQDIIRHNVQGLLGMLPGEQFEVKVTSNRDNLANMLASAMMTGYFLRQMEQRKELEESL 104
599******************************************************************************97 PP
Or compare VIMSS1364299 to CDD or PaperBLAST