VIMSS140182 has 56 amino acids
Query: DUF1508 [M=48]
Accession: PF07411.16
Description: Domain of unknown function (DUF1508)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.7e-23 67.5 0.0 4.2e-23 67.3 0.0 1.1 1 VIMSS140182
Domain annotation for each sequence (and alignments):
>> VIMSS140182
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.3 0.0 4.2e-23 4.2e-23 1 48 [] 8 55 .. 8 55 .. 0.97
Alignments for each domain:
== domain 1 score: 67.3 bits; conditional E-value: 4.2e-23
DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48
D++G++r+rLkaaN+e+Ia++egY+sk++++++++ k+ + ++v++
VIMSS140182 8 DAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKE 55
889**************************************9999987 PP
Or compare VIMSS140182 to CDD or PaperBLAST