VIMSS140305 has 91 amino acids
Query: DUF493 [M=84] Accession: PF04359.20 Description: Protein of unknown function (DUF493) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-35 107.2 0.0 2.9e-35 107.1 0.0 1.0 1 VIMSS140305 Domain annotation for each sequence (and alignments): >> VIMSS140305 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.1 0.0 2.9e-35 2.9e-35 2 84 .] 9 91 .] 8 91 .] 0.99 Alignments for each domain: == domain 1 score: 107.1 bits; conditional E-value: 2.9e-35 DUF493 2 elleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84 +l+eFPc+fp+kv+G+ ++efe+av++ v+ hap+++++++++rpSskg+Y+ tv+v ve++eqld+iyraL++he vk+vL VIMSS140305 9 SLIEFPCTFPLKVMGAVHPEFEQAVLDTVRLHAPDTQAHHITTRPSSKGNYTGATVQVKVENQEQLDNIYRALTSHELVKVVL 91 69*******************************************************************************98 PP
Or compare VIMSS140305 to CDD or PaperBLAST