VIMSS140305 has 91 amino acids
Query: DUF493 [M=84]
Accession: PF04359.18
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-35 108.0 0.0 1.7e-35 107.8 0.0 1.0 1 VIMSS140305
Domain annotation for each sequence (and alignments):
>> VIMSS140305
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 107.8 0.0 1.7e-35 1.7e-35 2 84 .] 9 91 .] 8 91 .] 0.99
Alignments for each domain:
== domain 1 score: 107.8 bits; conditional E-value: 1.7e-35
DUF493 2 elleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84
+l+eFPc+fp+kv+G+ ++efe+av+++v+ hap+++++++++rpSskg+Y+ tv+v ve++eqld+iyraL++he vk+vL
VIMSS140305 9 SLIEFPCTFPLKVMGAVHPEFEQAVLDTVRLHAPDTQAHHITTRPSSKGNYTGATVQVKVENQEQLDNIYRALTSHELVKVVL 91
69*******************************************************************************98 PP
Or compare VIMSS140305 to CDD or PaperBLAST