VIMSS144675 has 64 amino acids
Query: DUF2635 [M=46]
Accession: PF10948.12
Description: Protein of unknown function (DUF2635)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.9e-27 78.8 0.3 1.2e-26 78.5 0.3 1.1 1 VIMSS144675
Domain annotation for each sequence (and alignments):
>> VIMSS144675
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.5 0.3 1.2e-26 1.2e-26 1 45 [. 3 47 .. 3 48 .. 0.97
Alignments for each domain:
== domain 1 score: 78.5 bits; conditional E-value: 1.2e-26
DUF2635 1 vkPaeGlkVRdPetgqlLpaeGeevprtsyWlRRlkdGDVvlvke 45
vkP++G++VRdP++g++Lp+ G+evp++++W+RRl+dGDVv++ +
VIMSS144675 3 VKPMAGRAVRDPVKGTFLPEFGTEVPDNAFWRRRLQDGDVVQIAA 47
9****************************************9976 PP
Or compare VIMSS144675 to CDD or PaperBLAST