VIMSS144695 has 75 amino acids
Query: DUF1414 [M=44]
Accession: PF07208.15
Description: Protein of unknown function (DUF1414)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-28 84.0 0.4 3.7e-28 83.6 0.4 1.2 1 VIMSS144695
Domain annotation for each sequence (and alignments):
>> VIMSS144695
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 83.6 0.4 3.7e-28 3.7e-28 1 44 [] 26 69 .. 26 69 .. 0.99
Alignments for each domain:
== domain 1 score: 83.6 bits; conditional E-value: 3.7e-28
DUF1414 1 HkApvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44
H++p+DLsLMvLGN+vTn++n+s+++aqR+++A +Fa+AL++Sv
VIMSS144695 26 HRTPTDLSLMVLGNMVTNLINTSIAPAQRKVLARSFAEALQASV 69
9******************************************8 PP
Or compare VIMSS144695 to CDD or PaperBLAST