VIMSS145747 has 121 amino acids
Query: DUF1289 [M=48] Accession: PF06945.17 Description: Protein of unknown function (DUF1289) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-23 66.2 4.7 1.4e-22 65.6 4.7 1.2 1 VIMSS145747 Domain annotation for each sequence (and alignments): >> VIMSS145747 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.6 4.7 1.4e-22 1.4e-22 1 47 [. 54 99 .. 54 100 .. 0.98 Alignments for each domain: == domain 1 score: 65.6 bits; conditional E-value: 1.4e-22 DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47 sPC g+C++d ++g+CrGC+R++dE+++W +m+d ++r+vl+ +++r VIMSS145747 54 SPCRGICQTD-DRGFCRGCFRSRDERFNWIKMDDGQKREVLRLCHQR 99 9*********.***********************************9 PP
Or compare VIMSS145747 to CDD or PaperBLAST