VIMSS145747 has 121 amino acids
Query: DUF1289 [M=47]
Accession: PF06945.18
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.2e-23 67.3 4.6 6.1e-23 66.8 4.6 1.2 1 VIMSS145747
Domain annotation for each sequence (and alignments):
>> VIMSS145747
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.8 4.6 6.1e-23 6.1e-23 1 46 [. 54 99 .. 54 100 .. 0.98
Alignments for each domain:
== domain 1 score: 66.8 bits; conditional E-value: 6.1e-23
DUF1289 1 sPCigvCkldedglCrGCgRtldEiaaWssmsdeerravlarlaer 46
sPC g+C++d++g+CrGC+R++dE+++W +m+d ++r+vl+ +++r
VIMSS145747 54 SPCRGICQTDDRGFCRGCFRSRDERFNWIKMDDGQKREVLRLCHQR 99
9********************************************9 PP
Or compare VIMSS145747 to CDD or PaperBLAST