VIMSS14603 has 53 amino acids
Query: DUF2496 [M=43] Accession: PF10689.14 Description: Protein of unknown function (DUF2496) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-28 83.7 2.2 3.4e-28 83.5 2.2 1.1 1 VIMSS14603 Domain annotation for each sequence (and alignments): >> VIMSS14603 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.5 2.2 3.4e-28 3.4e-28 1 43 [] 2 44 .. 2 44 .. 0.99 Alignments for each domain: == domain 1 score: 83.5 bits; conditional E-value: 3.4e-28 DUF2496 1 sLenApeevkLAVDLImLLEsnqiepevalaALeIVkrDfekK 43 sLenAp++vkLAVDLI+LLE+nqi++ ++l+AL+IVkrD+ekK VIMSS14603 2 SLENAPDDVKLAVDLIVLLEENQIPASTVLRALDIVKRDYEKK 44 8*****************************************9 PP
Or compare VIMSS14603 to CDD or PaperBLAST