VIMSS14603 has 53 amino acids
Query: DUF2496 [M=43]
Accession: PF10689.13
Description: Protein of unknown function (DUF2496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-28 83.7 2.2 3.4e-28 83.5 2.2 1.1 1 VIMSS14603
Domain annotation for each sequence (and alignments):
>> VIMSS14603
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 83.5 2.2 3.4e-28 3.4e-28 1 43 [] 2 44 .. 2 44 .. 0.99
Alignments for each domain:
== domain 1 score: 83.5 bits; conditional E-value: 3.4e-28
DUF2496 1 sLenApeevkLAVDLImLLEsnqiepevalaALeIVkrDfekK 43
sLenAp++vkLAVDLI+LLE+nqi++ ++l+AL+IVkrD+ekK
VIMSS14603 2 SLENAPDDVKLAVDLIVLLEENQIPASTVLRALDIVKRDYEKK 44
8*****************************************9 PP
Or compare VIMSS14603 to CDD or PaperBLAST