VIMSS14605 has 125 amino acids
Query: DUF454 [M=115] Accession: PF04304.18 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-46 142.4 17.3 3.6e-46 142.2 17.3 1.0 1 VIMSS14605 Domain annotation for each sequence (and alignments): >> VIMSS14605 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 142.2 17.3 3.6e-46 3.6e-46 1 114 [. 3 116 .. 3 117 .. 0.99 Alignments for each domain: == domain 1 score: 142.2 bits; conditional E-value: 3.6e-46 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlaafcfarssprlhrwLlehklfgpyirdwrekraiplkaKvialllmllsllislllveslwvkill 99 r++l+++G+l+++lG++G+vlP+LPTtpF+Llaa+cfarsspr+h+wLl +++fg+y+r w++++a+p+ +K +a+ll+ll+++isl++v+++wv+i+l VIMSS14605 3 RIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPRFHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIML 101 799************************************************************************************************ PP DUF454 100 llvlllvllyllrlp 114 l++l+++l+y++r+p VIMSS14605 102 LVILACLLFYMWRIP 116 *************98 PP
Or compare VIMSS14605 to CDD or PaperBLAST