VIMSS14716 has 82 amino acids
Query: DUF1158 [M=79]
Accession: PF06643.15
Description: Protein of unknown function (DUF1158)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-50 154.3 10.3 5.9e-50 154.2 10.3 1.0 1 VIMSS14716
Domain annotation for each sequence (and alignments):
>> VIMSS14716
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 154.2 10.3 5.9e-50 5.9e-50 1 79 [] 1 79 [. 1 79 [. 1.00
Alignments for each domain:
== domain 1 score: 154.2 bits; conditional E-value: 5.9e-50
DUF1158 1 mkhpletllsaagilllallsclllpapslglalaqklvetfhlmdlnqlytllfclwflllgaveylvirfiwrrwfs 79
mkhpletl +aagill+a+lsclllpap+lglalaqklv++fhlmdl qlytllfclwfl+lga+ey+v+rfiwrrwfs
VIMSS14716 1 MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFS 79
9*****************************************************************************8 PP
Or compare VIMSS14716 to CDD or PaperBLAST